PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl002414
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Nin-like
Protein Properties Length: 478aa    MW: 51979.5 Da    PI: 7.9325
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-175a-Picea_glauca-10923PU_refplantGDBView CDS
gnl|UG|Pgl#S40903620PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.91.1e-291363252
     RWP-RK  2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
               ek+isle+l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Pgl002414 13 EKTISLEVLQQYFAGSLKDAAKNIGVCPTTLKRICRQHGISRWPSRKINKV 63
               799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029283IPR003035RWP-RK domain
PfamPF020426.3E-261563IPR003035RWP-RK domain
SuperFamilySSF542771.18E-23380467No hitNo description
SMARTSM006663.0E-22382464IPR000270PB1 domain
PROSITE profilePS5174519.989382456IPR000270PB1 domain
PfamPF005642.0E-16385461IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.1E-23385464No hitNo description
CDDcd064075.95E-31386463No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
IRTLLEKKRG KMEKTISLEV LQQYFAGSLK DAAKNIGVCP TTLKRICRQH GISRWPSRKI  60
NKVNRSLKKL QGVIESVKGV GAFKIGNLST GLVSAATVPN TSSVHGKSSP AVVQGAANHD  120
LDMVPPPSNE EVIGIKTSLP GKDCIMPEDF SSSQCQVIAT LGTSLSSRLQ SIKSGSTHIF  180
QETYSVGHAV HVKDVTLDEN TNGNLHRVEN GHVSYVHGAT NGISESRNSE SPQESIRTPS  240
SQASHPDLSQ IYLNSIEDHA DPPTITAFSR PPASQCHGGG ENLMSQLEFI NNGETSLHKR  300
QATSSILKNT HSETAVNCKR KKLPVESSSD QKPTDFSGQG ECLAEAIQSN SRNLSPQHRC  360
DSRILNLAGL QRDRIIQEGN KSTIFKVTYK QDTVRFRLPL NAGVSELHDE VTKRFKLEAG  420
TFDLKYLDDD HEWVLLACDA DLQECIGILN LSGGKAIKLV VYDMSSNVGS SCESSGEL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pgl.17670.0root| somatic embryo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5A7X90.0D5A7X9_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-36Nin-like family protein